PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA026775-PA
Common NameOsI_29655
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bHLH
Protein Properties Length: 180aa    MW: 18569.6 Da    PI: 6.7981
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA026775-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH32.21.9e-10138167130
                       CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC CS
               HLH   1 rrrahnerErrRRdriNsafeeLrellPka 30 
                       +r++h ++Er+RR+++N+ ++ Lr+l+P +
  BGIOSGA026775-PA 138 QRMTHIAVERNRRKQMNEYLAVLRSLMPAS 167
                       79**************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474594.22E-9131173IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000831.29E-8136171No hitNo description
Gene3DG3DSA:4.10.280.101.6E-9136172IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088811.223137180IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000108.5E-8138167IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MALEAVVFSE GYYFGCGGAM AAEAAAGGAW SWSHGYGGGV DQGKGAMELV VDDGVVNAFW  60
DGGGGGASSS PVMAAVSGFI EEPDGGNSSV ADAAPPPEHG GASVVGRDGS AAAPAAAAGR  120
RKRRRARTVK NREEVESQRM THIAVERNRR KQMNEYLAVL RSLMPASYVQ RGSSSQFIST
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1120124RKRRR
2138149RMTHIAVERNRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.551740.0panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329928350.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1076260.0AK107626.1 Oryza sativa Japonica Group cDNA clone:002-131-D10, full insert sequence.
GenBankHQ8588610.0HQ858861.1 Oryza sativa Japonica Group isolate UT1670 bHLH transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649413.12e-90PREDICTED: transcription factor bHLH96
TrEMBLB8BBT91e-127B8BBT9_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA026775-PA1e-126(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP74138156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22490.13e-22bHLH family protein